Cilp1 antibody

WebThis product is a recombinant monoclonal antibody, which offers several advantages including: - High batch-to-batch consistency and reproducibility - Improved sensitivity and specificity - Long-term security of supply - Animal-free … WebOct 28, 2011 · CILP-1 is a pro-form of two polypeptides, and is cleaved into distinct N- and C-terminal fragments at a furin endoprotease consensus site ( 7 ). The N-terminal of CILP-1 has been shown to bind to and inhibit TGFβ1 in vitro ( 8 …

Recombinant Human CILP-1 Protein, CF 5504-CP-050: R&D …

WebJun 1, 2024 · Cilp1 polyclonal antibody was raised in rabbits against a synthetic peptide (RQTMLAQSVRRVQPVKRTPKTLAKPADSQE) corresponding to preproCILP1 22-51, after conjugating with keyhole limpet hemocyanin via its C-terminal cysteine. Antibodies for immunofluorescence staining of 4′, 6-diamidino-2-phenylindole (DAPI) and alpha-smooth … WebCD74, also known as CLIP, is a 33.5kD homotrimer and functions as a MHC class II chaperone for exogenous peptides and other MHC class II molecules. CD74 binds MIF and regulates innate and adaptive immunity through CD44 signaling. It is found primarily on B-cells, monocytes, macrophages and dendritic shari headley christopher martin https://vape-tronics.com

User Clip: Trump Comments on Future Economic Relief Bill

WebNov 22, 2024 · CILP1 is an extracellular matrix (ECM) protein abundant in articular cartilage 6 and has been implicated in several diseases … WebAntibody [NBP1-81667] CILP-1 Antibody by Novus Biologicals. Menu Sign in or Register Search; Custom Suppliers; Data; Citations; Images; Listing; Contact; ... O75339 - … WebOct 6, 2024 · Rationale: Cartilage intermediate layer protein 1 (Cilp1) is a secreted extracellular matrix (ECM) protein normally associated with bone and cartilage development. Its function and mechanism of... poppins day nursery cheadle

(PDF) Matricellular Protein Cilp1 Promotes Myocardial Fibrosis …

Category:Human CILP-1 N-Terminal Fragment Antibody AF5504: …

Tags:Cilp1 antibody

Cilp1 antibody

CLP1 Antibody MBS9610091 from MyBioSource.com

WebThe CILP-1 (cartilage intermediate-layer protein 1) gene product is a 132 kDa (predicted) monomeric glycoprotein that is found in both hyaline and fibrocartilage. It is a precursor for two secreted, proteolytically generated products, a 90 kDa N-terminal CILP-1, and a 62 kDa C-terminal NTPPHase-homolog. WebThe CILP-1 (cartilage intermediate-layer protein 1) gene product is a 132 kDa (predicted) monomeric glycoprotein that is found in both hyaline and fibrocartilage. It is a precursor for two secreted, …

Cilp1 antibody

Did you know?

Web购物车里没有产品. Anti-MHC Class II Antibody [6C6] (ab55152) 产品货号 产品 WebBackground. Cytoplasmic FMR1-interacting protein 1 (CYFIP1) is a component of the CYFIP1/EIF4E/FMR1 complex which mediates translational repression by binding …

WebPolyclonal Antibody for studying CLIP1/CLIP170. Cited in 5 publications. Validated for Western Blotting. Highly specific and rigorously validated in-house, CLIP1/CLIP170 Antibody (CST #8977) is ready to ship. WebCILP-1 HsT18872 Background Major alterations in the composition of the cartilage extracellular matrix occur in joint disease, such as osteoarthrosis. This gene encodes the cartilage intermediate layer protein (CILP), which increases in early osteoarthrosis cartilage.

WebCited in 1 publication. View Human CILP-1 N-Terminal Fragment Antibody (AF5504) validated in Human & Simple Western, Western Blot from R&D Systems, Inc. a Bio-Techne Brand. WebThis product is a recombinant monoclonal antibody, which offers several advantages including: - High batch-to-batch consistency and reproducibility - Improved sensitivity and …

WebBackground: CILP-1 The CILP-1 (cartilage intermediate-layer protein 1) gene product is a monomeric glycoprotein precursor of two secreted, proteolytically generated products, a 90 kDa N-terminal CILP-1, and a 62 kDa C-terminal NTPPHase-homolog. It is found in both hyaline and fibrocartilage.

Webab251162 is the carrier-free version of ab192881. Our carrier-free antibodies are typically supplied in a PBS-only formulation, purified and free of BSA, sodium azide and glycerol. … shari havens berkshire hathawayWebJan 15, 2024 · Background. CILP, Cartilage Intermediate Layer Protein, is specifically expressed in the articular cartilage intermediate layer (it cannot be found in the … shari headley and christopher martinWeb(A06239) Anti-CILP1 Antibody (A06239) Supplier Boster Biological Technology. Host Rabbit View Product On Supplier's Website. Add to Procurement List Product is on your … shari headley daughterWebThe CILP-1 (cartilage intermediate-layer protein 1) gene product is a 132 kDa (predicted) monomeric glycoprotein that is found in both hyaline and fibrocartilage. It is a precursor … shari headley actressWebListed below are anti-CILP-1 antibodies from multiple suppliers. CILP-1 is a reported alias name for the human gene CILP, or 'cartilage intermediate layer protein'. The 1184-amino acid protein has a reported mass of 132,565 daltons. The cellular localization is predicted to be secreted. Glycosylation sites have been reported. poppins day nursery worcesterWebHuman CILP-1 N-Terminal Fragment Biotinylated Antibody. Cat # BAF5504. Human URB Antibody. Cat # AF3410. Citations (1) Recombinant Human Protocadherin gamma C3 Protein, CF. ... (CILP1): A novel mediator of cardiac extracellular matrix remodelling Authors: FA van Nieuwe, C Munts, RC Op't Veld, A González, J Díez, S Heymans, B ... poppins day nursery rugeleyWebBoster Bio Anti-CILP1 Antibody catalog # A06239. Tested in ELISA, WB applications. This antibody reacts with Human. Supplied as 100ul in Liquid form antibody. Anti-CILP1 … poppins dynamic metrics